The domain within your query sequence starts at position 40 and ends at position 201; the E-value for the DAGAT domain shown below is 2.9e-55.

VMLVLYNYWFLYIPYLVWFYYDWRTPEQGGRRWNWVQSWPVWKYFKEYFPICLVKTQDLD
PGHNYIFGFHPHGIFVPGAFGNFCTKYSDFKKLFPGFTSYLHVAKIWFCFPLFREYLMSN
GPVSVSKESLSHVLSKDGGGNVSIIVLGGAKEALEAHPGTFT

DAGAT

DAGAT
PFAM accession number:PF03982
Interpro abstract (IPR007130): The terminal step of triacylglycerol (TAG) formation is catalysed by the enzyme diacylglycerol acyltransferase (DAGAT) [(PUBMED:11751830), (PUBMED:11751875)].
GO function:transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAGAT