The domain within your query sequence starts at position 40 and ends at position 82; the E-value for the DAGAT domain shown below is 1.9e-9.

VMLVLYNYWFLYIPYLVWFYYDWRTPEQGGRRWNWVQSWPVWK

DAGAT

DAGAT
PFAM accession number:PF03982
Interpro abstract (IPR007130):

The terminal step of triacylglycerol (TAG) formation is catalysed by the enzyme diacylglycerol acyltransferase (DAGAT) [ (PUBMED:11751830) (PUBMED:11751875) ].

GO function:transferase activity, transferring acyl groups other than amino-acyl groups (GO:0016747)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAGAT