SMART: Pfam domain DAG_kinase

The domain within your query sequence starts at position 5 and ends at position 172; the E-value for the DAG_kinase_N domain shown below is 3.9e-54.

QWVSLSSEEFDQLQKYSEYSSKKIKDVLAEFNEGGSLRQYDPHKPISYDVFKLFMRAYLE
VDLPQPLSTHLFLAFSQKPRQETPDHPKEGASSSEPNVSDYNSDNAAKADEACAPDTESK
TTKTQAPSKELEAAAPWEDPGALASSSDAPVVYLKDVVCYLSLMETGR

DAG_kinase_N

PFAM accession number:	PF14513
Interpro abstract (IPR029477):	This domain is found at the N terminus of the EF-hand domain of the type I diacylglycerol kinases (DGKs). DGKs phosphorylate diacylglycerol (DAG) to produce phosphatidic acid (PA) and play an important role in signal transduction by modulating the balance between these signalling lipids. DGKs can be classified into five types. Proteins containing this domain are EF-hand domain containing type I DGKs, including DGK-alpha, beta and gamma [ (PUBMED:22984004) ].

PFAM accession number:

PF14513

Interpro abstract (IPR029477):

This domain is found at the N terminus of the EF-hand domain of the type I diacylglycerol kinases (DGKs). DGKs phosphorylate diacylglycerol (DAG) to produce phosphatidic acid (PA) and play an important role in signal transduction by modulating the balance between these signalling lipids. DGKs can be classified into five types. Proteins containing this domain are EF-hand domain containing type I DGKs, including DGK-alpha, beta and gamma [ (PUBMED:22984004) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAG_kinase_N