The domain within your query sequence starts at position 51 and ends at position 168; the E-value for the DAN domain shown below is 1.2e-23.

NQTMNRAENGGRPPHHPYDAKDVSEYSCRELHYTRFLTDGPCRSAKPVTELVCSGQCGPA
RLLPNAIGRVKWWRPNGPDFRCIPDRYRAQRVQLLCPGGAAPRSRKVRLVASCKCKRL

DAN

DAN
PFAM accession number:PF03045
Interpro abstract (IPR004133): This domain contains 9 conserved cysteines and is extracellular. Therefore the cysteines may form disulphide bridges. This family of proteins has been termed the DAN family [(PUBMED:9660951)] after the first member to be reported. This family includes DAN, Cerberus and Gremlin. The gremlin protein is an antagonist of bone morphogenetic protein signalling. It is postulated that all members of this family antagonize different TGF beta TGF-beta ligands [(PUBMED:9660951)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAN