The domain within your query sequence starts at position 462 and ends at position 588; the E-value for the DAO_C domain shown below is 2.1e-42.

SRTVGLFLQGGKDWSPTLYIRLVQDYGLESEVAQHLAKTYGDKAFEVAKMASVTGKRWPV
VGVRLVSEFPYIEAEVKYGIKEYACTAVDMISRRTRLAFLNVQAAEEALPRIVELMGREL
NWSELRK

DAO_C

DAO_C
PFAM accession number:PF16901
Interpro abstract (IPR031656):

This entry represents the C-terminal domain of alpha-glycerophosphate oxidase, also known as glycerol-3-phosphate oxidase (EC 1.1.5.3) [(PUBMED:18154320)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAO_C