The domain within your query sequence starts at position 13 and ends at position 106; the E-value for the DAP domain shown below is 4.2e-27.
KGRYAPAVKAGGMRISKKQEMGVLERHTKKTGLEKTSAITNVAKIQMLDALTDTLDKLNH KFPATVHTAHQKPTPALEKAAPMKRAYIIQQPRK
DAP |
---|
PFAM accession number: | PF15228 |
---|---|
Interpro abstract (IPR024130): | This family includes death-associated protein 1 (DAP1) and death-associated protein-like 1 (DAPL1). DAP1 is involved in mediating interferon-gamma-induced cell death [ (PUBMED:7828849) ]. DAPL1 may play a role in the early stages of epithelial differentiation or in apoptosis [ (PUBMED:15920738) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAP