The domain within your query sequence starts at position 2 and ends at position 165; the E-value for the DARPP-32 domain shown below is 2.2e-43.

EPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEIDEDRIPNSLLK
STLSMSPRQRKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPDT
GSASRPDTPGTAQKSAESNPKTQEQCGVEPRTEDSSAHMLPLDS

DARPP-32

DARPP-32
PFAM accession number:PF05395
Interpro abstract (IPR008466): This entry represents the protein phosphatase inhibitor 1 (IPP-1) family, which consists of PPP1R1A/B/C. They are involved in signal transduction and are endogenous inhibitors of protein phosphatase-1 [(PUBMED:10960791)]. PPP1R1B, also known as DARPP-32, has a key role in many neurotransmitter pathways throughout the brain and has been shown to be involved in controlling receptors, ion channels and other physiological factors including the brain's response to drugs of abuse, such as cocaine, opiates and nicotine. If phosphorylated, DARPP-32 can inhibit protein-phosphatase-1 [(PUBMED:12543476)]. DARPP-32 is reciprocally regulated by the two neurotransmitters that are most often implicated in schizophrenia - dopamine and glutamate. Dopamine activates DARPP-32 through the D1 receptor pathway and disables DARPP-32 through the D2 receptor. Glutamate, acting through the N-methyl-d-aspartate receptor, renders DARPP-32 inactive. A mutant form of DARPP-32 has been linked with gastric cancers [(PUBMED:12124342)].
GO process:signal transduction (GO:0007165)
GO function:protein phosphatase inhibitor activity (GO:0004864)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DARPP-32