The domain within your query sequence starts at position 184 and ends at position 230; the E-value for the DASH_Hsk3 domain shown below is 2.6e-18.
AREKNQLILENEALGRNTAQLSEQLERMSIQCDVWRSKFLASRVMAD
DASH_Hsk3 |
---|
PFAM accession number: | PF08227 |
---|---|
Interpro abstract (IPR013183): | This entry includes Hsk3, Hos3 and Golgin-45. Hsk3 is a subunit of the DASH complex, which is a ~10 subunit microtubule-binding complex that is transferred to the kinetochore prior to mitosis [ (PUBMED:11799062) ]. In Saccharomyces cerevisiae DASH forms both rings and spiral structures on microtubules in vitro [ (PUBMED:15640796) (PUBMED:15664196) ]. This family also includes several higher eukaryotic proteins. However, other DASH subunits do not appear to be conserved in higher eukaryotes. Golgin-45 is required for normal Golgi structure and for protein transport from the endoplasmic reticulum (ER) through the Golgi apparatus to the cell surface. It interacts with GORASP2 and with the GTP-bound form of RAB2, but not with other Golgi Rab proteins [ (PUBMED:11739401) ]. Hos3 (High osmolarity sensitivity protein 3) may play a role in the progression of mitosis in an environment of high osmotic stress [ (PUBMED:10879493) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DASH_Hsk3