The domain within your query sequence starts at position 35 and ends at position 168; the E-value for the DAZAP2 domain shown below is 7.1e-48.
YTDAPPAYSELYRPSFVHPGAATVPTMSAAFPGASLYLPMAQSVAVGPLGSTIPMAYYPV GPIYPPGSAVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKG NFFMGGSDGGYTIW
DAZAP2 |
---|
PFAM accession number: | PF11029 |
---|---|
Interpro abstract (IPR022730): | DAZ associated protein 2 has a highly conserved sequence throughout evolution including a conserved polyproline region and several SH2/SH3 binding sites. It occurs as a single copy gene with a four-exon organisation and is located on chromosome 12. It encodes a ubiquitously expressed protein and binds to DAZ and DAZL1 through DAZ repeats [ (PUBMED:10857750) (PUBMED:15629043) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DAZAP2