The domain within your query sequence starts at position 48 and ends at position 259; the E-value for the DCAF15_WD40 domain shown below is 1.1e-84.
QLSPRLFRKLPPRVCVSLKNIVDEDFLYAGHIFLGFSKCGRYVLSYTSSSGDDDFSFYIY HLYWWEFNVHSKLKLVRQVRLFQDEEIYSDLYLTVCEWPSDASKVIVFGFNTRSANGMLM NMMMMSDENHRDIYISTVAVPPRGRCAACQDASRAHPGDPSAQCLRHGFMLHTKYQVVYP FPTFQPAFQLKKDQVVLLNTSYSLVACAVSVH
DCAF15_WD40 |
---|
PFAM accession number: | PF14939 |
---|---|
Interpro abstract (IPR032734): | DCAFs, Ddb1- and Cul4-associated factors, are substrate receptors for the Cul4-Ddb1 Ubiquitin Ligase. There are 18 different factors, the majority of which are WD40-repeat-proteins [ (PUBMED:16949367) ]. This entry represents the WD40 repeat-containing domain found in DCAF15. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCAF15_WD40