The domain within your query sequence starts at position 7 and ends at position 200; the E-value for the DCB domain shown below is 1.6e-40.

KSMFVSRALEKILADKEVKRPQHSQLRRACQVALDEIKAELEKQRLGAAAPPKANFIEAD
KYFLPFELACQSKSPRVVSTSLDCLQKLIAYGHITGNAPDSGAPGKRLIDRIVETICNCF
QGPQTDEGVQLQIIKALLTAVTSPHIEIHEGTILQTVRTCYNIYLASKNLINQTTAKATL
TQMLNVIFTRMENQ

DCB

DCB
PFAM accession number:PF16213
Interpro abstract (IPR032629):

This is the N-terminal domain of Mon2- and BIG1-like proteins. The N terminus of Mon2 (Ysl2) binds to Arf-Like small GTPase Arl1, and shows homology to brefeldin A-inhibited guanine-exchange factor (BIG) domains [(PUBMED:12052896)]. Mon2 and BIG1-like proteins play an important role in membrane traffic and Golgi homeostasis [(PUBMED:16219684), (PUBMED:16301316), (PUBMED:18417613)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCB