The domain within your query sequence starts at position 10 and ends at position 131; the E-value for the DCP1 domain shown below is 1.3e-53.
PGKGHDISLAALRRHDPYISRIVDVASQVALYTFGHRANEWEKTGVEGTLFVYTRSASPK HGFTIMNRLSMENRTEPITKDLDFQLQNPFLLYRNGTLSIYGIWFYDKEECQRIAKLMKN LT
DCP1 |
![]() |
---|
PFAM accession number: | PF06058 |
---|---|
Interpro abstract (IPR010334): | An essential step in mRNA turnover is decapping. In yeast, two proteins have been identified that are essential for decapping, Dcp1 (this family) and Dcp2. Dcp1 is a coactivator that binds to the decapping enzyme Dcp2 and forms a decapping enzyme complex, which removes the 5' cap structure from mRNAs prior to their degradation [ (PUBMED:16341225) ]. Yeast Dcp1 interact directly with Dcp2, however, the Dcp1-Dcp2 interaction is promoted by an additional factor, EDC4 [ (PUBMED:24510189) ]. |
GO process: | positive regulation of catalytic activity (GO:0043085), deadenylation-dependent decapping of nuclear-transcribed mRNA (GO:0000290) |
GO function: | enzyme activator activity (GO:0008047) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCP1