The domain within your query sequence starts at position 13 and ends at position 129; the E-value for the DCP1 domain shown below is 3e-46.

GHDISLAALRRHDPYISRIVDVASQVALYTFGHRANEWEKTGVEGTLFVYTRSASPKHGF
TIMNRLSMENRTEPITKDLDFQLQNPFLLYRNGTLSIYGIWFYDKEECQRIAKLMKN

DCP1

DCP1
PFAM accession number:PF06058
Interpro abstract (IPR010334):

An essential step in mRNA turnover is decapping. In yeast, two proteins have been identified that are essential for decapping, Dcp1 (this family) and Dcp2. Dcp1 is a coactivator that binds to the decapping enzyme Dcp2 and forms a decapping enzyme complex, which removes the 5' cap structure from mRNAs prior to their degradation [ (PUBMED:16341225) ]. Yeast Dcp1 interact directly with Dcp2, however, the Dcp1-Dcp2 interaction is promoted by an additional factor, EDC4 [ (PUBMED:24510189) ].

GO process:deadenylation-dependent decapping of nuclear-transcribed mRNA (GO:0000290), positive regulation of catalytic activity (GO:0043085)
GO function:enzyme activator activity (GO:0008047)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCP1