The domain within your query sequence starts at position 221 and ends at position 287; the E-value for the DCR domain shown below is 1.5e-41.
GEMWCVVHGTSLPGNSRGWVRLQFHAGQAWVPDKKGKAIALFLLPACTFPPPHLEDNMLC PKCVHKN
DCR |
---|
PFAM accession number: | PF14047 |
---|---|
Interpro abstract (IPR025891): | This domain has been characterised in the finding of a developmental pluripotency associated gene (Dppa) in the lower vertebrate Xenopus laevis [ (PUBMED:19772919) ]. Previous to this discovery, Dppa genes were known only in higher vertebrates. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCR