The domain within your query sequence starts at position 221 and ends at position 287; the E-value for the DCR domain shown below is 1.5e-41.

GEMWCVVHGTSLPGNSRGWVRLQFHAGQAWVPDKKGKAIALFLLPACTFPPPHLEDNMLC
PKCVHKN

DCR

DCR
PFAM accession number:PF14047
Interpro abstract (IPR025891):

This domain has been characterised in the finding of a developmental pluripotency associated gene (Dppa) in the lower vertebrate Xenopus laevis [(PUBMED:19772919)]. Previous to this discovery, Dppa genes were known only in higher vertebrates.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DCR