The domain within your query sequence starts at position 431 and ends at position 621; the E-value for the DC_STAMP domain shown below is 1.5e-55.

FDNIYISTYFCQIDARRKKLGKQSLLPLRKAERKTVIFPFKATIQAWEMRYVIRELLETL
PIVLLLLVLCAIDWALYSVFDTIRQHSFVQYSFRSSHKLEIKVEGDSILAKLLRKTIGAL
NTSSSTDVETNNMPCLPQPISLNARDYFKASLPTLLLVCLCLAQAFGYRLRRVIAAFYFP
KREKKRALFFY

DC_STAMP

DC_STAMP
PFAM accession number:PF07782
Interpro abstract (IPR012858):

This group of sequences is similar to a region of the dendritic cell-specific transmembrane protein (DC-STAMP, Q9H295). This is thought to be a novel receptor protein that shares no identity with other multimembrane-spanning proteins [(PUBMED:11169400)]. It is thought to have seven putative transmembrane regions [(PUBMED:11169400)], two of which are found in the region featured in this family. DC-STAMP is also described as having potential N-linked glycosylation sites and a potential phosphorylation site for PKC [(PUBMED:11169400)], but these are not conserved.

GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DC_STAMP