The domain within your query sequence starts at position 206 and ends at position 385; the E-value for the DDE_1 domain shown below is 1e-58.
EERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQW FDKIFVPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIFAKYLPPNVASLIQP LGQGVIAAMKRNYRAGLLHNNLEEGNDLKSFWKKLTLLDALYEIAMAWNLVKPVTISRAW
DDE_1 |
---|
PFAM accession number: | PF03184 |
---|---|
Interpro abstract (IPR004875): | Proteins containing this domain are probably endonucleases of the DDE superfamily. This domain contains three carboxylate residues that are believed to be responsible for coordinating metal ions needed for catalysis. The catalytic activity of this enzyme involves DNA cleavage at a specific site followed by a strand transfer reaction. Proteins containing this domain include tigger transposable element derived proteins from mammals [ (PUBMED:15487591) ] and protein Pdc2 from budding yeasts [ (PUBMED:22404710) ]. Interestingly, proteins conatining this domain also includes the Centromere Protein B (CENP-B) protein, which appears to have lost the metal binding residues in this domain and is unlikely to have endonuclease activity. CENP-B is a an inner kinetochore protein that binds to a specific centromere sequence [ (PUBMED:18072184) ]. |
GO function: | nucleic acid binding (GO:0003676) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDE_1