The domain within your query sequence starts at position 29 and ends at position 395; the E-value for the DDE_Tnp_1_7 domain shown below is 2e-86.

SAVDFFQLFVPDNVLKNMVVQTNMYARKFQERFGSDGAWVEVTLAEMKAFLGYVISTSVS
HCESVLSIWSGGFYSNRSLALVMSQARFEKILKYFHVVAFRSSQTTHGLYKVQPFLDSLQ
SGFDAAFRPSQTQVLHEPLIDEDPVFIATCTERELRKRKKRKFSLWVRQCSSTGFIIQIY
VHLKEGGGPDGLDALKNKPQLHSMVARSLCRNAAGKNYIIFTGPSITSLNLFEEFEKQGI
YCCGLLSSRKSDCTGLPPSMLTNPATPLARGQHQIRTKGNMSLICWYNKGHFRFLTNAYS
PVQKGVIIKRRSGEIPCPLAVEAFAAHLSYICRYDDKYSKYFISHKPNKTWQQVFWFAIS
IAVNNAY

DDE_Tnp_1_7

DDE_Tnp_1_7
PFAM accession number:PF13843
Interpro abstract (IPR029526): This entry represents a domain found in the human PiggyBac transposable element-derived proteins (PGBDs) and some uncharacterised proteins. Its function is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDE_Tnp_1_7