The domain within your query sequence starts at position 148 and ends at position 300; the E-value for the DDE_Tnp_4 domain shown below is 1.7e-40.

ADCIHVAIKAPNAEDLSYVNRKGLHSLNCLVVCDIRGALMTVETSWPGSLQDCAVLQRSS
LTSQFETGMPKDSWLLGDSSFFLRSWLLTPLPIPETAAEYRYNRAHSATHSVIERTLQTL
CCRFRCLDGSKGALQYSPEKCSHIILACCVLHN

DDE_Tnp_4

DDE_Tnp_4
PFAM accession number:PF13359
Interpro abstract (IPR027806):

This domain is found in proteins that are related to IPR001584 and are probably endonucleases of the DDE superfamily. Proteins containing this domain include the putative nuclease HARBI1. HARBI1 is a transposase-derived protein that may have nuclease activity potential. It does not have transposase activity [(PUBMED:15169610), (PUBMED:18339812)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDE_Tnp_4