The domain within your query sequence starts at position 148 and ends at position 300; the E-value for the DDE_Tnp_4 domain shown below is 1.7e-40.
ADCIHVAIKAPNAEDLSYVNRKGLHSLNCLVVCDIRGALMTVETSWPGSLQDCAVLQRSS LTSQFETGMPKDSWLLGDSSFFLRSWLLTPLPIPETAAEYRYNRAHSATHSVIERTLQTL CCRFRCLDGSKGALQYSPEKCSHIILACCVLHN
DDE_Tnp_4 |
---|
PFAM accession number: | PF13359 |
---|---|
Interpro abstract (IPR027806): | This domain is found in proteins that are related to IPR001584 and are probably endonucleases of the DDE superfamily. Proteins containing this domain include the putative nuclease HARBI1. HARBI1 is a transposase-derived protein that may have nuclease activity potential. It does not have transposase activity [ (PUBMED:15169610) (PUBMED:18339812) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DDE_Tnp_4