The domain within your query sequence starts at position 1 and ends at position 88; the E-value for the DEAD_2 domain shown below is 1.3e-33.

QDLATPILDIEDLVKNGSKQKMCPYYLSRNMKQQADIIFMPYNYLLDAKSRKAHSIDLKG
TVVIFDEAHNVEKICEESASFDLTPRDV

DEAD_2

DEAD_2
PFAM accession number:PF06733
Interpro abstract (IPR010614):

This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin. RAD3 is involved in nucleotide excision repair, and forms part of the transcription factor TFIIH in yeast [ (PUBMED:10915862) ].

GO function:DNA binding (GO:0003677), DNA helicase activity (GO:0003678), ATP binding (GO:0005524)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEAD_2