The domain within your query sequence starts at position 251 and ends at position 302; the E-value for the DEK_C domain shown below is 3.1e-13.

ERLIKTKLREIMMQKDLENITSKEIRTELEMQMVCNLREFKEFIDNEMIVIL

DEK_C

DEK_C
PFAM accession number:PF08766
Interpro abstract (IPR014876):

DEK is a chromatin associated protein that is linked with cancers and autoimmune disease. This domain is found at the C-terminal of DEK and is of clinical importance since it can reverse the characteristic abnormal DNA-mutagen sensitivity in fibroblasts from ataxia-telangiectasia (A-T) patients [(PUBMED:7504406)]. The structure of this domain shows it to be homologous to the E2F/DP transcription factor family [(PUBMED:15238633)]. This domain is also found in chitin synthase proteins like Q8TF96, and in protein phosphatases such as Q6NN85.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEK_C