The domain within your query sequence starts at position 43 and ends at position 88; the E-value for the DEP domain shown below is 5.2e-10.

GVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLI

DEP

DEP
PFAM accession number:PF00610
Interpro abstract (IPR000591):

This entry represents the DEP (Dishevelled, Egl-10 and Pleckstrin) domain, a globular domain of about 80 residues that is found in over 50 proteins involved in G-protein signalling pathways. It was named after the three proteins it was initially found in:

  • Dishevelled (Dsh and Dvl), which play a key role in the transduction of the Wg/Wnt signal from the cell surface to the nucleus; it is a segment polarity protein required to establish coherent arrays of polarized cells and segments in embryos, and plays a role in wingless signalling.
  • Egl-10, which regulates G-protein signalling in the central nervous system.
  • Pleckstrin, the major substrate of protein kinase C in platelets; Pleckstrin contains two PH domains flanking the DEP domain.

Mammalian regulators of G-protein signalling also contain these domains, and regulate signal transduction by increasing the GTPase activity of G-protein alpha subunits, thereby driving them into their inactive GDP-bound form. It has been proposed that the DEP domain could play a selective role in targeting DEP domain-containing proteins to specific subcellular membranous sites, perhaps even to specific G protein-coupled signaling pathways [ (PUBMED:10987813) (PUBMED:11101902) ]. Nuclear magnetic resonance spectroscopy has revealed that the DEP domain comprises a three-helix bundle, a beta-hairpin 'arm' composed of two beta-strands and two short beta-strands in the C-terminal region [ (PUBMED:11101902) ].

GO process:intracellular signal transduction (GO:0035556)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEP