The domain within your query sequence starts at position 43 and ends at position 88; the E-value for the DEP domain shown below is 5.2e-10.
GVPIRTVKSFLSKIPSVVTGTDIVQWLMKNLSIEDPVEAIHLGSLI
DEP |
---|
PFAM accession number: | PF00610 |
---|---|
Interpro abstract (IPR000591): | This entry represents the DEP (Dishevelled, Egl-10 and Pleckstrin) domain, a globular domain of about 80 residues that is found in over 50 proteins involved in G-protein signalling pathways. It was named after the three proteins it was initially found in:
Mammalian regulators of G-protein signalling also contain these domains, and regulate signal transduction by increasing the GTPase activity of G-protein alpha subunits, thereby driving them into their inactive GDP-bound form. It has been proposed that the DEP domain could play a selective role in targeting DEP domain-containing proteins to specific subcellular membranous sites, perhaps even to specific G protein-coupled signaling pathways [ (PUBMED:10987813) (PUBMED:11101902) ]. Nuclear magnetic resonance spectroscopy has revealed that the DEP domain comprises a three-helix bundle, a beta-hairpin 'arm' composed of two beta-strands and two short beta-strands in the C-terminal region [ (PUBMED:11101902) ]. |
GO process: | intracellular signal transduction (GO:0035556) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DEP