The domain within your query sequence starts at position 13 and ends at position 203; the E-value for the DER1 domain shown below is 7.4e-72.

VPAVTRAYTAACVLTTAAVQLELLSPFQLYFNPHLVFRKFQVWRLITTFLFFGPLGFGFF
FNMLFVFRYCRMLEEGSFRGRKADFVFMFLFGGVLMTLLGFLGSLFFLGQALMAMLVYVW
SRRSPHVRVNFFGLLNFQAPFLPWALMGFSLLLGNSVVTDLLGILVGHIYYFLEDVFPNQ
PGGKRLLLTPS

DER1

DER1
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DER1