The domain within your query sequence starts at position 40 and ends at position 196; the E-value for the DERM domain shown below is 1e-37.

NLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAG
MEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDM
ISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDC

DERM

 DERM
PFAM accession number:PF14704
Interpro abstract (IPR026645):

This family includes dermatopontin, millepora cytotoxin-1 and hemagglutinin/amebocyte aggregation factor.

Dermatopontin is a small molecular weight protein in the extracellular matrix, which has been reported to be involved in different functions [ (PUBMED:16987749) ]. It seems to mediate adhesion by cell surface integrin binding [ (PUBMED:19928997) ]. It interacts with transforming growth factor beta [ (PUBMED:9895299) ]. A role of this protein in cell proliferation [ (PUBMED:14980498) ] and collagen fibrillogenesis [ (PUBMED:12230512) ] has also been reported.

Millepora cytotoxin-1 is a toxin from fire coral with hemagglutination activity on erythrocytes [ (PUBMED:17983598) ].

Hemagglutinin/amebocyte aggregation factor is able to induce both aggregation of amebocytes and agglutination of erythrocytes [ (PUBMED:1429596) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DERM