The domain within your query sequence starts at position 40 and ends at position 196; the E-value for the DERM domain shown below is 1e-37.

NLNRQGFSYQCPHGQVVVAVRSIFSKKEGSDRQWNYACMPTPQSLGEPTECWWEEINRAG
MEWYQKCSNNGLVAGFQSRYFESVLDREWQFYCCRYSKRCPYSCWMTTEYPSHYGEDMDM
ISYDYDFYMRGATTTFSAVERDRQWKFIMCRMTDYDC

DERM

DERM
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DERM