The domain within your query sequence starts at position 103 and ends at position 324; the E-value for the DFF40 domain shown below is 9.4e-97.

IQAARQLLSDEQAPLRQKLLADLLHHVSQNITAETREQDPSWFEGLESRFRNKSGYLRYS
CESRIRGYLREVSAYTSMVDEAAQEEYLRVLGSMCQKLKSVQYNGSYFDRGAEASSRLCT
PEGWFSCQGPFDLESCLSKHSINPYGNRESRILFSTWNLDHIIEKKRTVVPTLAEAIQDG
REVNWEYFYSLLFTAENLKLVHIACHKKTTHKLECDRSRIYR

DFF40

DFF40
PFAM accession number:PF09230
Interpro abstract (IPR015311):

Apoptosis, or programmed cell death (PCD), is a common and evolutionarily conserved property of all metazoans [(PUBMED:11341280)]. In many biological processes, apoptosis is required to eliminate supernumerary or dangerous (such as pre-cancerous) cells and to promote normal development. Dysregulation of apoptosis can, therefore, contribute to the development of many major diseases including cancer, autoimmunity and neurodegenerative disorders. In most cases, proteins of the caspase family execute the genetic programme that leads to cell death.

DNA fragmentation factor (DFF) is a complex of the DNase DFF40 (CAD) and its chaperone/inhibitor DFF45 (ICAD-L). In its inactive form, DFF is a heterodimer composed of a 45kDa chaperone inhibitor subunit (DFF45 or ICAD), and a 40kDa latent endonuclease subunit (DFF40 or CAD). Upon caspase-3 cleavage of DFF45, DFF40 forms active endonuclease homo-oligomers. It is activated during apoptosis to induce DNA fragmentation. DNA binding by DFF is mediated by the nuclease subunit, which can also form stable DNA complexes after release from DFF [(PUBMED:17626049), (PUBMED:15572351)]. The nuclease subunit is inhibited in DNA cleavage but not in DNA binding [(PUBMED:15572351)]. DFF45 can also be cleaved and inactivated by caspase-7 but not by caspase-6 and caspase-8. The cleaved DFF45 fragments dissociate from DFF40, allowing DFF40 to oligomerise, forming a large complex that cleaves DNA by introducing double strand breaks. Histone H1 confers DNA binding ability to DFF and stimulates the nuclease activity of DFF40 [(PUBMED:10318789)].

GO process:apoptotic DNA fragmentation (GO:0006309)
GO component:nucleus (GO:0005634), cytoplasm (GO:0005737)
GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DFF40