SMART: Pfam domain DFRP

The domain within your query sequence starts at position 229 and ends at position 336; the E-value for the DFRP_C domain shown below is 4.2e-23.

EISLEDLIERERSALGPNVTKITLESFLAWKKRKRQEKIDKLEQDMERRKADFKAGKALV
ISGREVFEFRPELVNDDDEEADDTRYIQGTGGDEVDDSMGVNDIDISL

DFRP_C

PFAM accession number:	PF16543
Interpro abstract (IPR032378):	This entry represents the C-terminal domain of the translation machinery-associated protein 46 (Tma46), a binding partner for the highly conserved developmentally regulated GTP-binding (DRG) GTPases. The interaction between Tma46 and Rbg1 GTPase (a DRG protein) modulates the function of the GTPase [ (PUBMED:23002146) ]. This domain is also found in ZC3H15 (zinc finger CCCH domain-containing protein 15), also known as DFRP1 (DRG family regulatory protein 1) [ (PUBMED:23624947) ].

PFAM accession number:

PF16543

Interpro abstract (IPR032378):

This entry represents the C-terminal domain of the translation machinery-associated protein 46 (Tma46), a binding partner for the highly conserved developmentally regulated GTP-binding (DRG) GTPases. The interaction between Tma46 and Rbg1 GTPase (a DRG protein) modulates the function of the GTPase [ (PUBMED:23002146) ]. This domain is also found in ZC3H15 (zinc finger CCCH domain-containing protein 15), also known as DFRP1 (DRG family regulatory protein 1) [ (PUBMED:23624947) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DFRP_C