The domain within your query sequence starts at position 1 and ends at position 198; the E-value for the DGCR6 domain shown below is 4e-97.
MDRYAAAGDEAADRARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSDLALALLDGTV FEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQTLRQKHLEAQQSCRPHNLPVLQAAQQ RELESWQAMEHRIREEQQAMDRKIVLELDRKVADQQSTLEKAGVAGFYVTTNPQELTLQM NLLELIRKLQQRGCQVGK
DGCR6 |
![]() |
---|
PFAM accession number: | PF07324 |
---|---|
Interpro abstract (IPR010849): | This family contains DiGeorge syndrome critical region 6 (DGCR6) proteins (approximately 200 residues long) of a number of vertebrates. DGCR6 is a candidate for involvement in the DiGeorge syndrome pathology by playing a role in neural crest cell migration into the third and fourth pharyngeal pouches, the structures from which derive the organs affected in DiGeorge syndrome [(PUBMED:8733130)]. Also found in this family is the Drosophila melanogaster gonadal protein gdl. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DGCR6