The domain within your query sequence starts at position 305 and ends at position 878; the E-value for the DHC_N1 domain shown below is 9.1e-154.

PELVENLEQCVIHWLGQISYALDSQMKKKPQGNGPLAEIEFWRERNATLSALYEQTKLPF
VRKVLEVIKEAESMLTANVQPILTELFKLHMEASDNVRFLSTVERHFKNITHGSSFHVVL
DTIPSMMSALRMVWIISRHYNRDERMIPLMERIAWEIAERVCRVINLRTLFKENRANAQF
KTQEARNTLKLWKKSYFDIRAKIEASGREARWEFDRKRLFERTDYMANICQDLSDVLQVL
EEFYNIFGPELKAVTGDPKRIDDVLGRVDSLVAPMESLSFDPFSIRSSPYWKYVMEDFKL
EVLVIEKEAKNFIDESFKTLRSAEAAFDMLLKFKHIRSREAINRQMMMKFNDILAQYYKE
IDIVNKIFVQNQDNPPLYKNHPPVAGAICWERSLFYRIKHTILRFMEVEELLDSERGQQV
KQRYLEVGRKMKEYEDGKYEHWKETTEQSLPTLMKKSLLTKNIITAEDSAIIDRGTTFII
NFSPVLKEIINETKYLEQLGFTIPELARNVALQEDKFLRYTEGIQRMLDHYHLLINTLNE
AETALLDDHSQELLRVFRSGYKRLNWNSLGISDY

DHC_N1

DHC_N1
PFAM accession number:PF08385
Interpro abstract (IPR013594):

Dynein heavy chains interact with other heavy chains to form dimers, and with intermediate chain-light chain complexes to form a basal cargo binding unit [(PUBMED:10862709)]. The region featured in this family includes the sequences implicated in mediating these interactions [(PUBMED:10336435)]. It is thought to be flexible and not to adopt a rigid conformation [(PUBMED:10862709)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHC_N1