The domain within your query sequence starts at position 1317 and ends at position 1721; the E-value for the DHC_N2 domain shown below is 3.3e-116.

VQVALEELQDLKGVWSELSKVWEQIDQMKEQPWVSVQPRKLRQNLDGLLNQLKNFPARLR
QYASYEFVQRLLKGYMKINMLVIELKSEALKDRHWKQLMKRLHVNWVVSELTLGQIWDVD
LQKNEAVVKDVLLVAQGEMALEEFLKQIREVWNTYELDLVNYQNKCRLIRGWDDLFNKVK
EHINSVSAMKLSPYYKVFEEDALSWEDKLNRIMALFDVWIDVQRRWVYLEGIFTGSADIK
HLLPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQRSLERLADLLGKIQKALGEY
LERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMFAGVSSIILNEDNSVVLGISS
REGEEVMFKTPVSITEHPKINEWLTLVEKEMRVTLAKLLAESVTE

DHC_N2

DHC_N2
PFAM accession number:PF08393
Interpro abstract (IPR013602):

Dyneins are described as motor proteins of eukaryotic cells, as they can convert energy derived from the hydrolysis of ATP to force and movement along cytoskeletal polymers, such as microtubules. Dyneins generally contain one to three heavy chains, where each heavy chain consists of a C-terminal globular head, a flexible microtubule-binding stalk, and a flexible N-terminal tail known as the cargo-binding domain [(PUBMED:15661525)]. The two categories of dyneins are the axonemal dyneins, which produce the bending motions that propagate along cilia and flagella, and the cytosolic dyneins, which drive a variety of fundamental cellular processes including nuclear migration, organisation of the mitotic spindle, chromosome separation during mitosis, and the positioning and function of many intracellular organelles. Cytoplasmic dyneins contain several accessory subunits ranging from light to intermediate chains.

This entry represents a region found C-terminal to the dynein heavy chain N-terminal region 1 (IPR013594) in many members of this family. No functions seem to have been attributed specifically to this region.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHC_N2