SMART: Pfam domain DHH

The domain within your query sequence starts at position 19 and ends at position 181; the E-value for the DHH domain shown below is 2.5e-10.

HVVLGNEACDLDSMVSALALAFYLTKTSEAEDIFIPVLNIKRSELPLRGDNVFFLQEVKI
PEPALIFRDEIDLLALHQAGQLTLILVDHHILPKSDAALEEAVAEVLDHRPIEQKYCPPC
HVSVELVGSCATLVTERILQGAPETLDRQTAALLHGTIILDCV

DHH

PFAM accession number:	PF01368
Interpro abstract (IPR001667):	This is a domain of predicted phosphoesterases, including Drosophila prune protein and bacterial RecJ exonuclease [ (PUBMED:9478130) ]. The RecJ protein of Escherichia coli plays an important role in a number of DNA repair and recombination pathways. RecJ catalyzes processive degradation of single-stranded DNA in a 5'-to-3' direction. Sequences highly related to those encoding RecJ can be found in many of the eubacterial genomes sequenced to date [ (PUBMED:10633092) ].

PFAM accession number:

PF01368

Interpro abstract (IPR001667):

This is a domain of predicted phosphoesterases, including Drosophila prune protein and bacterial RecJ exonuclease [ (PUBMED:9478130) ]. The RecJ protein of Escherichia coli plays an important role in a number of DNA repair and recombination pathways. RecJ catalyzes processive degradation of single-stranded DNA in a 5'-to-3' direction. Sequences highly related to those encoding RecJ can be found in many of the eubacterial genomes sequenced to date [ (PUBMED:10633092) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHH