The domain within your query sequence starts at position 885 and ends at position 957; the E-value for the DHHA1 domain shown below is 1.6e-12.
TSAMLFTVDNEAGKITCLCQVPQNAANRGLKASEWVQQVSGLMDGKGGGKDMSAQATGKN VGCLQEALQLATS
DHHA1 |
---|
PFAM accession number: | PF02272 |
---|---|
Interpro abstract (IPR003156): | This domain is often found adjacent to the DHH domain ( IPR001667 ), and is called DHHA1 for DHH associated domain. DHHA1 is diagnostic of DHH subfamily 1 members [ (PUBMED:9478130) ]. This domain is also found in alanyl tRNA synthetase (e.g., P00957 ), suggesting that it may have an RNA binding function. The domain is about 60 residues long and contains a conserved GG motif. |
GO function: | nucleic acid binding (GO:0003676) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DHHA1