The domain within your query sequence starts at position 4 and ends at position 136; the E-value for the DIM1 domain shown below is 1.2e-58.

LLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSADLSKMAAIYLVDV
DHTPVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGA
MRGKLIVQSPIDP

DIM1

 DIM1
PFAM accession number:PF02966
Interpro abstract (IPR004123):

This entry represents fission yeast Dim1 and its homologues, including Dib1 from budding yeasts, YLS8 from plants and TXNL4 from animals. Dim1 was originally identified as a mitosis protein [(PUBMED:9182666)]. Later, it was found to interact with spliceosome component Prp6, which is involved in pre-mRNA splicing [(PUBMED:11054566)]. Dim1 may act at the level of mRNA, which impacts the functioning of the APC/C, a critical complex in controlling mitotic progression [(PUBMED:15755920)].

It's worth noting that although the Dim proteins exhibit a thioredoxin-like fold, they lack the disulfide bond required for the thioredoxin redox activity [(PUBMED:17558560)].

GO process:mRNA splicing, via spliceosome (GO:0000398)
GO component:U4/U6 x U5 tri-snRNP complex (GO:0046540)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DIM1