The domain within your query sequence starts at position 4 and ends at position 136; the E-value for the DIM1 domain shown below is 3.4e-73.
MLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDI TEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGA RKGRGLVVSPKDY
DIM1 |
---|
PFAM accession number: | PF02966 |
---|---|
Interpro abstract (IPR004123): | This entry represents fission yeast Dim1 and its homologues, including Dib1 from budding yeasts, YLS8 from plants and TXNL4 from animals. Dim1 was originally identified as a mitosis protein [ (PUBMED:9182666) ]. Later, it was found to interact with spliceosome component Prp6, which is involved in pre-mRNA splicing [ (PUBMED:11054566) ]. Dim1 may act at the level of mRNA, which impacts the functioning of the APC/C, a critical complex in controlling mitotic progression [ (PUBMED:15755920) ]. It's worth noting that although the Dim proteins exhibit a thioredoxin-like fold, they lack the disulfide bond required for the thioredoxin redox activity [ (PUBMED:17558560) ]. |
GO process: | mRNA splicing, via spliceosome (GO:0000398) |
GO component: | U4/U6 x U5 tri-snRNP complex (GO:0046540) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DIM1