The domain within your query sequence starts at position 485 and ends at position 721; the E-value for the DLH domain shown below is 4.8e-8.

EAILLQPSNSPDKSQVPMVVMPHGGPHSSFVTAWMLFPAMLCKMGFAVLLVNYRGSTGFG
QDSILSLPGNVGHQDVKDVQFAVQQVLQEEHFDARRVALMGGSHGGFLSCHLIGQYPETY
SACIARNPVINIVSMMGTTDIPDWCMVETGFPYSNDYLPDLNVLEEMLDKSPIKYIPQVK
TPVLLMLGQEDRRVPFKQGLEYYHALKARNVPVRLLLYPKSTHALSEVEVESDSFMN

DLH

DLH
PFAM accession number:PF01738
Interpro abstract (IPR002925): Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway. Enzymes induced in 4-fluorobenzoate-utilizing bacteria have been classified into three groups on the basis of their specificity towards cis- and trans-dienelactone [(PUBMED:7684040)]. Some proteins contain repeated small fragments of this domain (for example rat kan-1 protein).
GO function:hydrolase activity (GO:0016787)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DLH