The domain within your query sequence starts at position 54 and ends at position 135; the E-value for the DLL_N domain shown below is 6.1e-21.
QESPTLPVSTATDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDL GYTAAYTSYAPYGTSSSPVNNE
DLL_N |
 |
|---|
| PFAM accession number: | PF12413 |
|---|---|
| Interpro abstract (IPR022135): | This domain is found in eukaryotes, and is approximately 80 amino acids in length. It is found in association with . It is found at the N terminus of a homeobox protein involved in embryonic development and adult neural regeneration [ (PUBMED:8798159) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DLL_N