The domain within your query sequence starts at position 314 and ends at position 350; the E-value for the DMA domain shown below is 3.3e-21.

RDPLGILTRIFPGYKHSRLEGILQFCKGDVVQAIEQI

DMA

 DMA
PFAM accession number:PF03474
Interpro abstract (IPR005173):

This region is found to the C terminus of the DM DNA-binding domain IPR001275 [ (PUBMED:10729224) ]. DM-domain proteins with this motif are known as DMRTA proteins. The function of this region is unknown.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DMA