The domain within your query sequence starts at position 243 and ends at position 404; the E-value for the DMAP1 domain shown below is 7.1e-76.

EEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAEKP
AVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGVELSPTPTEELVH
MFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVL

DMAP1

DMAP1
PFAM accession number:PF05499
Interpro abstract (IPR008468):

This entry represents a domain found in DNA methyltransferase 1-associated protein 1 (DMAP1).

DNA methylation can contribute to transcriptional silencing through several transcriptionally repressive complexes, which include methyl-CpG binding domain proteins (MBDs) and histone deacetylases (HDACs). The chief enzyme that maintains mammalian DNA methylation, DNMT1, can also establish a repressive transcription complex. The non-catalytic N terminus of DNMT1 binds to HDAC2 and DMAP1, and can mediate transcriptional repression. DMAP1 has intrinsic transcription repressive activity, and binds to the transcriptional co-repressor TSG101. DMAP1 is targeted to replication foci through interaction with the far N terminus of DNMT1 throughout S phase, whereas HDAC2 joins DNMT1 and DMAP1 only during late S phase, providing a platform for how histones may become deacetylated in heterochromatin following replication [(PUBMED:10888872)].

GO process:negative regulation of transcription, DNA-templated (GO:0045892)
GO component:nucleus (GO:0005634)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DMAP1