The domain within your query sequence starts at position 97 and ends at position 179; the E-value for the DNA_binding_1 domain shown below is 8.2e-29.
SFTRQVLWKLLKVVKFGETVSYQQLAALAGNPKAARAVGGAMRSNPVPILIPCHRVVRSD GAIGHYSGGGQAVKEWLLAHEGI
DNA_binding_1 |
 |
|---|
| PFAM accession number: | PF01035 |
|---|---|
| Interpro abstract (IPR014048): | Synonym(s): 6-O-methylguanine-DNA methyltransferase, O-6-methylguanine-DNA-alkyltransferase This entry represents the DNA binding region of 6-O-methylguanine-DNA methyltransferases. The repair of DNA containing O6-alkylated guanine is carried out by DNA-[protein]-cysteine S-methyltransferase ( EC 2.1.1.63 ). The major mutagenic and carcinogenic effect of methylating agents in DNA is the formation of O6-alkylguanine. The alkyl group at the O-6 position is transferred to a cysteine residue in the enzyme [ (PUBMED:3052269) ]. This is a suicide reaction since the enzyme is irreversibly inactivated and the methylated protein accumulates as a dead-end product. Most, but not all of the methyltransferases are also able to repair O-4-methylthymine. DNA-[protein]-cysteine S-methyltransferases are widely distributed and are found in various prokaryotic and eukaryotic sources [ (PUBMED:1579490) ]. |
| GO process: | DNA repair (GO:0006281) |
| GO function: | catalytic activity (GO:0003824) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_binding_1