The domain within your query sequence starts at position 750 and ends at position 783; the E-value for the DNA_ligase_IV domain shown below is 5.5e-17.
TKQHFAREYDCYGDSYFVDTDLDQLKEVFLGIKP
DNA_ligase_IV |
 |
|---|
| PFAM accession number: | PF11411 |
|---|---|
| Interpro abstract (IPR021536): | This entry represents the DNA ligase IV (Lig4) sequences between the two BRCA1 C-terminal (BRCT) domains. Lig4 along with Xrcc4 functions in DNA non-homologous end joining. This process is required to mend double-strand breaks. Upon ligase binding to an Xrcc4 dimer, the helical tails unwind leading to a flat interaction surface [ (PUBMED:11702069) ]. |
| GO function: | DNA ligase (ATP) activity (GO:0003910) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_ligase_IV