The domain within your query sequence starts at position 749 and ends at position 784; the E-value for the DNA_ligase_IV domain shown below is 7.3e-21.

STKQHFAREYDCYGDSYFVDTDLDQLKEVFLGIKPS

DNA_ligase_IV

DNA_ligase_IV
PFAM accession number:PF11411
Interpro abstract (IPR021536):

This entry represents the DNA ligase IV (Lig4) sequences between the two BRCA1 C-terminal (BRCT) domains. Lig4 along with Xrcc4 functions in DNA non-homologous end joining. This process is required to mend double-strand breaks. Upon ligase binding to an Xrcc4 dimer, the helical tails unwind leading to a flat interaction surface [(PUBMED:11702069)].

GO function:DNA ligase (ATP) activity (GO:0003910)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_ligase_IV