The domain within your query sequence starts at position 1024 and ends at position 1478; the E-value for the DNA_methylase domain shown below is 8e-50.

RTLDVFSGCGGLSEGFHQAGISETLWAIEMWDPAAQAFRLNNPGTTVFTEDCNVLLKLVM
AGEVTNSLGQRLPQKGDVEMLCGGPPCQGFSGMNRFNSRTYSKFKNSLVVSFLSYCDYYR
PRFFLLENVRNFVSYRRSMVLKLTLRCLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAA
PGEKLPLFPEPLHVFAPRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEIQN
GASNSEIPYNGEPLSWFQRQLRGSHYQPILRDHICKDMSPLVAARMRHIPLFPGSDWRDL
PNIQVRLGDGVIAHKLQYTFHDVKNGYSSTGALRGVCSCAEGKACDPESRQFSTLIPWCL
PHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGKQGRVLHPEQHRVVSVRECARSQGFP
DSYRFFGNILDRHRQVGNAVPPPLAKAIGLEIKLC

DNA_methylase

DNA_methylase
PFAM accession number:PF00145
Interpro abstract (IPR001525):

C-5 cytosine-specific DNA methylases (EC 2.1.1.37) (C5 Mtase) are enzymes that specifically methylate the C-5 carbon of cytosines in DNA to produce C5-methylcytosine [(PUBMED:3248729), (PUBMED:8127644), (PUBMED:2716049)]. In mammalian cells, cytosine-specific methyltransferases methylate certain CpG sequences, which are believed to modulate gene expression and cell differentiation. In bacteria, these enzymes are a component of restriction-modification systems and serve as valuable tools for the manipulation of DNA [(PUBMED:7773746), (PUBMED:8127644)]. The structure of HhaI methyltransferase (M.HhaI) has been resolved to 2.5 A [(PUBMED:8343957)]: the molecule folds into 2 domains - a larger catalytic domain containing catalytic and cofactor binding sites, and a smaller DNA recognition domain.

This entry also includes tRNA (cytosine(38)-C(5))-methyltransferase (EC 2.1.1.204), also known as DNMT2 (DNA (cytosine-5)-methyltransferase-like protein 2), that specifically methylates cytosine 38 in the anticodon loop of tRNA (Asp) [(PUBMED:16424344)].

GO function:methyltransferase activity (GO:0008168)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_methylase