The domain within your query sequence starts at position 287 and ends at position 489; the E-value for the DNA_pol_E_B domain shown below is 1.4e-58.

FVIVSDVWLDQVQVLEKFHVMFSGYSPAPPTCFILCGNFSSAPYGKNQVQALKDSLKSLA
DIICEYPSIHQSSRFVFVPGPEDPGFGSILPRPPLAESITQEFRQRVPFSVFTTNPCRIQ
YCTQEIIIFREDLVNKMCRNCVRFPSSSLDIPTHFVKTILSQGHLAPLPLYVCPVHWAYD
YTLRVYPVPDLLVIADKYDPFTV

DNA_pol_E_B

DNA_pol_E_B
PFAM accession number:PF04042
Interpro abstract (IPR007185): DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast. In addition, DNA polymerase epsilon may be involved in DNA repair and cell-cycle checkpoint control. The enzyme consists of at least four subunits in mammalian cells as well as in yeast. The largest subunit of DNA polymerase epsilon is responsible for polymerase activity. In mouse, the DNA polymerase epsilon subunit B is the second largest subunit of the DNA polymerase. A part of the N-terminal was found to be responsible for the interaction with SAP18. Experimental evidence suggests that this subunit may recruit histone deacetylase to the replication fork to modify the chromatin structure [(PUBMED:11872158)].
GO process:DNA replication (GO:0006260)
GO function:DNA binding (GO:0003677), DNA-directed DNA polymerase activity (GO:0003887)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_pol_E_B