SMART: Pfam domain DNA_pol_delta

The domain within your query sequence starts at position 23 and ends at position 98; the E-value for the DNA_pol_delta_4 domain shown below is 2.5e-23.

HSKGELAPELGEDTQSLSQEETELELLRQFDLAWQYGPCTGITRLQRWSRAEQMGLKPPL
EVYQVLKAHPEDPHFQ

DNA_pol_delta_4

PFAM accession number:	PF04081
Interpro abstract (IPR007218):	DNA polymerase delta (Pol delta) is responsible for effective DNA replication, playing a key role in the elongation of both the leading and the lagging strands of DNA and the maturation of Okazaki fragments [ (PUBMED:24035200) ]. It consists of four subunits: the catalytic and largest subunit p125, p50 that interacts with p125 to form the core enzyme, p68 which interacts with p50, and a fourth subunit, p12, that bridges p125 and p50, stabilising its interaction [ (PUBMED:16510448) (PUBMED:19074196) ]. This entry represents the p12 subunit (also called subunit 4), which increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymerase and proofreading 3' to 5' exonuclease activity in the Pol delta4 tetramer complex [ (PUBMED:16510448) (PUBMED:19074196) (PUBMED:20334433) ]. p12 is PCNA-binding protein, as it contains a N-terminal PCNA-binding motif. Under conditions of DNA replication stress, it is required for the repair of broken replication forks through break-induced replication (BIR), a mechanism that may induce segmental genomic duplications of up to 200 kb [ (PUBMED:24310611) ]. This subunit is involved in Pol-delta4 translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites [ (PUBMED:19074196) ]. p12 plays a major role in Pol delta4 catalytic functions while its degradation is required for the conversion of Pol delta4 to Pol delta3 in the cellular response to DNA damage, as Pol delta3 has an enhanced proofreading activity [ (PUBMED:24022480) ].
GO process:	DNA replication (GO:0006260), DNA synthesis involved in DNA repair (GO:0000731)

PFAM accession number:

PF04081

Interpro abstract (IPR007218):

DNA polymerase delta (Pol delta) is responsible for effective DNA replication, playing a key role in the elongation of both the leading and the lagging strands of DNA and the maturation of Okazaki fragments [ (PUBMED:24035200) ]. It consists of four subunits: the catalytic and largest subunit p125, p50 that interacts with p125 to form the core enzyme, p68 which interacts with p50, and a fourth subunit, p12, that bridges p125 and p50, stabilising its interaction [ (PUBMED:16510448) (PUBMED:19074196) ].

This entry represents the p12 subunit (also called subunit 4), which increases the rate of DNA synthesis and decreases fidelity by regulating POLD1 polymerase and proofreading 3' to 5' exonuclease activity in the Pol delta4 tetramer complex [ (PUBMED:16510448) (PUBMED:19074196) (PUBMED:20334433) ]. p12 is PCNA-binding protein, as it contains a N-terminal PCNA-binding motif. Under conditions of DNA replication stress, it is required for the repair of broken replication forks through break-induced replication (BIR), a mechanism that may induce segmental genomic duplications of up to 200 kb [ (PUBMED:24310611) ]. This subunit is involved in Pol-delta4 translesion synthesis (TLS) of templates carrying O6-methylguanine or abasic sites [ (PUBMED:19074196) ]. p12 plays a major role in Pol delta4 catalytic functions while its degradation is required for the conversion of Pol delta4 to Pol delta3 in the cellular response to DNA damage, as Pol delta3 has an enhanced proofreading activity [ (PUBMED:24022480) ].

GO process:

DNA replication (GO:0006260), DNA synthesis involved in DNA repair (GO:0000731)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_pol_delta_4