The domain within your query sequence starts at position 108 and ends at position 336; the E-value for the DNA_primase_S domain shown below is 9.7e-59.
FDIDMTDYDDVRRCCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRRGVHC WVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKYFEEYA LVGQDILENKENWDKILALVPETIHDELQRGFQKFHSSPQRWEHLRKVANSSQNMKNDKC GPWLEWEVMLQYCFPRLDVNVSKGVNHLLKSPFSVHPKTGRISVPIDFH
DNA_primase_S |
---|
PFAM accession number: | PF01896 |
---|---|
Interpro abstract (IPR002755): | This family represents the small subunit, and also includes baculovirus late expression factor 1 or LEF-1 proteins. Baculovirus LEF-1 is a DNA primase enzyme [ (PUBMED:11836407) ]. DNA primase synthesises the RNA primers for the Okazaki fragments in lagging strand DNA synthesis. DNA primase is a heterodimer of large and small subunits [ (PUBMED:2023935) ]. |
GO process: | DNA replication, synthesis of RNA primer (GO:0006269) |
GO function: | DNA primase activity (GO:0003896) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_primase_S