The domain within your query sequence starts at position 108 and ends at position 336; the E-value for the DNA_primase_S domain shown below is 9.7e-59.

FDIDMTDYDDVRRCCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRRGVHC
WVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKYFEEYA
LVGQDILENKENWDKILALVPETIHDELQRGFQKFHSSPQRWEHLRKVANSSQNMKNDKC
GPWLEWEVMLQYCFPRLDVNVSKGVNHLLKSPFSVHPKTGRISVPIDFH

DNA_primase_S

DNA_primase_S
PFAM accession number:PF01896
Interpro abstract (IPR002755):

DNA primase synthesises the RNA primers for the Okazaki fragments in lagging strand DNA synthesis. DNA primase is a heterodimer of large and small subunits. This family represents the small subunit, and also includes baculovirus late expression factor 1 or LEF-1 proteins. Baculovirus LEF-1 is a DNA primase enzyme [(PUBMED:11836407)].

GO process:DNA replication, synthesis of RNA primer (GO:0006269)
GO function:DNA primase activity (GO:0003896)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_primase_S