The domain within your query sequence starts at position 29 and ends at position 128; the E-value for the DNA_repr_REX1B domain shown below is 4.2e-28.
IATLVQRIQQLQNERAQAFRRLDQAHRQYLLSGQHYDFPSYRSVVHEVTQAFAAASREVL AVEAELAGPRAQPVLARHVRSLQELEQTRLATVALLQVMG
DNA_repr_REX1B |
 |
|---|
| PFAM accession number: | PF14966 |
|---|---|
| Interpro abstract (IPR039491): | This family of proteins includes Chlamydomonas reinhardtii REX1-B (Required for Excision 1-B) which is involved in a light-independent DNA repair pathway [ (PUBMED:12697762) ]. It also includes REX1-B domain-containing protein from mammals, whose function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNA_repr_REX1B