The domain within your query sequence starts at position 287 and ends at position 422; the E-value for the DNMT1-RFD domain shown below is 2.6e-40.

EDSPMHRFTSFSVYCSRGHLCPVDTGLIEKNVELYFSGCAKAIHDENPSMEGGINGKNLG
PINQWWLSGFDGGEKVLIGFSTAFAEYILMEPSKEYEPIFGLMQEKIYISKIVVEFLQNN
PDAVYEDLINKIETTV

DNMT1-RFD

DNMT1-RFD
PFAM accession number:PF12047
Interpro abstract (IPR022702):

This domain is part of a cytosine specific DNA methyltransferase enzyme (DNMT). It functions non-catalytically to target the protein towards replication foci. This allows the DNMT1 protein to methylate the correct residues. This domain targets DMAP1 and HDAC2 to the replication foci during the S phase of mitosis. They are thought to have some importance in conversion of critical histone lysine moieties [(PUBMED:10888872)].

A structure exists for the human cytosine specific DNA methyltransferase replication foci domain [(PUBMED:21389349)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DNMT1-RFD