The domain within your query sequence starts at position 556 and ends at position 737; the E-value for the DOCK-C2 domain shown below is 3.3e-58.
PNTTYRNLLYIYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMPVIFGKSSCSEFSKEA YTAVVYHNRSPDFHEEIKVKLPATLTDHHHLLFTFYHVSCQQKQNTPLETPVGYTWIPML QNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVFNVEVVAVSSIHTQDP YL
DOCK-C2 |
![]() |
---|
PFAM accession number: | PF14429 |
---|---|
Interpro abstract (IPR027007): | Rho guanosine triphosphatases (GTPases) are critical regulators of cell motility, polarity, adhesion, cytoskeletal organisation, proliferation, gene expression, and apoptosis. Conversion of these biomolecular switches to the activated GTP-bound state is controlled by two families of guanine nucleotide exchanges factors (GEFs). DH-PH proteins are a large group of Rho GEFs comprising a catalytic Dbl homology (DH) domain with an adjacent pleckstrin homology (PH) domain within the context of functionally diverse signalling modules. The evolutionarily distinct and smaller family of DOCK (dedicator of cytokinesis) or CDM (CED-5, DOCK1180, Myoblast city) proteins activate either Rac or Cdc42 to control cell migration, morphogenesis, and phagocytosis. DOCK proteins share the DOCK- homology region (DHR)-1 or CDM-zizimin homology 1 (CZH1) domain and the DHR-2 domain (also termed the CZH2 or DOCKER domain), [ (PUBMED:20713135) (PUBMED:12172552) (PUBMED:12432077) (PUBMED:20167601) (PUBMED:19745154) (PUBMED:21613211) ]. The ~200 residue DHR-1 domain is located toward the N terminus. It adopts a C2-like architecture and interacts with phosphatidylinositol 3,4,5-trisphosphate [ (PUBMED:19745154) ] to mediate signalling and membrane localization. The central core of the DHR-1 domain adopts an antiparallel beta-sandwich with the "type II" C2 domain fold (a circular permutation of the more common "type I" topology), in which two 4-stranded sheets with strand order 6-5-2-3 and 7-8-1-4 create convex- and concave-exposed faces, respectively [ (PUBMED:20167601) ]. Some DOCK proteins are listed below:
|
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DOCK-C2