SMART: Pfam domain DPCD

The domain within your query sequence starts at position 6 and ends at position 195; the E-value for the DPCD domain shown below is 4.5e-92.

WLEVLRSAEKTALLQDGKRMVHYLFPDGKEMAEEYDEKTSELLVRKWRVKNALGALGQWQ
LEVGEPVPSGAGSLGSELIKESNANPIFMRKDTKTSFQWRIRNLPYPKDVYSVSVAQKER
CVIVRTTNKKYYKKFSIPDLDRHQLPLEDSALSFAHANCTLIISYQKPKEVMAAESELQK
ELKKVKTAHG

DPCD

PFAM accession number:	PF14913
Interpro abstract (IPR026224):	Primary ciliary dyskinesia (PCD) is an autosomal recessive disease that results from mutations affecting the normal function of cilia. Expression of the DPCD product of the uncharacterised gene dpcd has been shown to increase during ciliated cell differentiation [ (PUBMED:14630615) ]. Nevertheless, an analysis of DPCD mutations in cases of human PCD was not able to confirm any specific disease-causing mutations, although one variant could not be ruled out. DPCD therefore remains a novel candidate gene for PCD [ (PUBMED:14630615) ].

PFAM accession number:

PF14913

Interpro abstract (IPR026224):

Primary ciliary dyskinesia (PCD) is an autosomal recessive disease that results from mutations affecting the normal function of cilia. Expression of the DPCD product of the uncharacterised gene dpcd has been shown to increase during ciliated cell differentiation [ (PUBMED:14630615) ]. Nevertheless, an analysis of DPCD mutations in cases of human PCD was not able to confirm any specific disease-causing mutations, although one variant could not be ruled out. DPCD therefore remains a novel candidate gene for PCD [ (PUBMED:14630615) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DPCD