The domain within your query sequence starts at position 56 and ends at position 317; the E-value for the DREV domain shown below is 1.4e-142.

WYVCNREKLCESLQSVFVQSYLDQGTQIFLNNSIEKSGWLFIQLYHSFVSSVFSLFMSRT
SINGLLGRGSMFVFSPDQFQRLLRINPDWKTHRLLDLGAGDGEVTKIMSPHFEEIYATEL
SETMIWQLQKKKYRVLGINEWQNTGFQYDVISCLNLLDRCDQPLTLLKDIRSVLEPTQGR
VILALVLPFHPYVENVGGKWEKPSEILEIKGQNWEEQVNSLPEVFRKAGFVVEAFTRLPY
LCEGDMYNDYYVLDDAVFVLRP

DREV

DREV
PFAM accession number:PF05219
Interpro abstract (IPR007884): This family contains DREV protein homologues from several eukaryotes. The function of this protein is unknown [(PUBMED:11132146)]. However, these proteins appear to be related to other methyltransferases.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DREV