The domain within your query sequence starts at position 910 and ends at position 1534; the E-value for the DRIM domain shown below is 2.6e-176.

RAAAKQLIAHLQVFSKFSNPRALYLESKLYELYLQLLLHQDQAVQKITLDCIMTYRHPHI
LPYRENLQRLLDDRSFKEEIVHFNISEDNTVVKAAHRADLFPILMRILYGRMKNKTGSKT
QGKSASGTRMAIVLRFLAGTQPEEIQLFLDLLSEPVKHFKDGDCCSAVIQAVEDLDVSKV
LPVGRQHGVLNSLEVVLKNISHLISTYLPKILQILLCMTATVSHILDQREKIQLRFINPL
KNLRRLGIKMVTDIFLDWESYQFKAEEIDAVFHGTVWPQICRLGSESQYSPTPLLKLISI
WSRNARYFPLLAKQKPGHPEYDILTNVFAVLSAKNLSEATASIIMDIVDDLLNLPDFQPT
EAVPSLPVTGCVYADVAEDTEPVTVGGRLVLPHVPAILQYLSKTTISAEKVKKKKNRAQV
SKELGILSKISKFMKDREQCSLLITLLLPFLLRGNVAQDTELDILVTVQNLLQHCLHPAH
FLRPLAKLFSVIKNKLSRQLLCTVFQSLSDFESRLKYITDIVKLNAFDKRHLDDINFDVR
FSAFQTITSNIKAMQTVDADYLIAVMHNCFYNMEIGDMSLSDNASICLTSIIKRLAALNV
TEKEYKEIIHRTLLEKLRKGLKSQT

DRIM

DRIM
PFAM accession number:PF07539
Interpro abstract (IPR011430):

These eukaryotic proteins include DRIM (Down-Regulated In Metastasis) (O75691), which is differentially expressed in metastatic and non-metastatic human breast carcinoma cells [(PUBMED:9673349)]. It is believed to be involved in processing of non-coding RNA [(PUBMED:12837249)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DRIM