The domain within your query sequence starts at position 903 and ends at position 1009; the E-value for the DRMBL domain shown below is 1.1e-38.

PEVSSLITTDMCDSLVHLLPMMQINFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITST
ADIIPQTRGNISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGS

DRMBL

DRMBL
PFAM accession number:PF07522
Interpro abstract (IPR011084):

The metallo-beta-lactamase fold contains five sequence motifs. The first four motifs are found in IPR001279 and are common to all metallo-beta-lactamases. The fifth motif appears to be specific to function. This entry represents the fifth motif from metallo-beta-lactamases involved in DNA repair [(PUBMED:12177301)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DRMBL